PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G167300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 865aa    MW: 95651.2 Da    PI: 6.4749
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G167300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.63.3e-25550601152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isle++++yFs+++k+AAk+Lgvc+T++KriCR+ GI+ WP+R i+++
  Brast08G167300.1.p 550 AEKTISLEVIQQYFSGSLKSAAKSLGVCPTTMKRICRKQGISQWPSREISKV 601
                         589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.143540621IPR003035RWP-RK domain
PfamPF020426.5E-22553601IPR003035RWP-RK domain
SuperFamilySSF542771.91E-22761851No hitNo description
PROSITE profilePS5174520.244769852IPR000270PB1 domain
SMARTSM006662.1E-21769852IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.0E-23770851No hitNo description
PfamPF005649.0E-15771851IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MDLDSSDSEA WLLDALATPL LFSAAAPLPW LCGDQHYSSS PIDTVSHLDE TPGTRSGESE  60
TATKKVENMN GKMQVPVSLD DDYSDCSYFM KERLTLALSY FKESTDQHLL VQVWVPTKNG  120
DQYVLTTSGQ PFLLDQESIK LVQYRAVSMT YAFSIDGENV HDLGLPGRVY KQRVPEWTPS  180
VQYYSSIEYP RLNHAINYNV HGTIALPVFD PSLKSCIGVV ELIMTSKKVN YASEVDKVCK  240
ALEAVNLKST KIVEHPCVQI CNESRQAALV EILEILTVVS EEFKLPLSQT WVPCKYQSLL  300
AHGGGVKRGC LSFGGSCMDE VCISTSDVAF HVIDAHMWGF RDACVAHHLQ KGQGVSGKAF  360
ISGRPCFSKD ISRFLKMEYP LVHYARMFGL AGCFSIYLQS TYTRDDYILE FFLPPDCRED  420
DEQKALLQSI IVLLRHHLRS LQVAGDEGLN EACLQVDAAT VMHNEENENT YVQDLNFGGG  480
IHPFLESDMH GGIHESNNRN HKASTVSKNY LLSHNYSGDK PVVIPSGSGT SDSLLLYKNK  540
KNPAKRRGKA EKTISLEVIQ QYFSGSLKSA AKSLGVCPTT MKRICRKQGI SQWPSREISK  600
VNKSISKLKE VIESSQASDS AFGFTSVTAP LHGLASSSYL LDKSSQDKTV EVYIPFGNEN  660
KASSSHKSLQ NCSWSIIMSP QTLLANNGNQ TEGDKATNSR SSSGQHSTNS QTSEGSYQGS  720
QGNEAFVGKS IASTFLDPQQ NNPQGFTKDS VRLTEVLPGR MMLPQNSGIV IVKAHYKEDI  780
LRFRFPCSGS LITLKQEVTK RIQINVTGTF CIKYLDDDHE WVNLTCEADL EECMEIYLLS  840
GFNVLRLLVT DNAVILRSSH GSSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753898.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0Q3R0L40.0A0A0Q3R0L4_BRADI; Uncharacterized protein
STRINGSi021160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein